-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EXOC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 650-745 of human EXOC3 (O60645) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EXOC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 650-745 of human EXOC3 (O60645) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13403A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EXOC3 |
| Target Synonyms | SEC6; Sec6p; SEC6L1; EXOC3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HepG2, MCF7, Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 650-745 of human EXOC3 (O60645). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EDVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK | Uniprot ID | O60645 |
Uniprot Id
O60645
Target Species
Human
Target Name
EXOC3
Target Full Name
Exocyst complex component 3
Target Function
Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.
Target Subcellular Location
Cytoplasm. Cytoplasm, perinuclear region. Cell projection, growth cone. Midbody. Golgi apparatus. Cell projection, neuron projection.
Target Protein Families
SEC6 family
Target Tissue Specificity
Expressed in epididymis (at protein level).
Target Synonyms
EXOC 3; Exoc3; EXOC3_HUMAN; Exocyst complex component 3; Exocyst complex component Sec 6; Exocyst complex component Sec6; rSec 6; Sec 6; Sec 6 homolog; Sec 6p; Sec6; SEC6 L1; SEC6 like 1; Sec6 protein; SEC6L1; Sec6p
Target Background
The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.
Notification