-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EYA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human EYA1 (NP_000494.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against EYA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human EYA1 (NP_000494.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00966A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EYA1 |
| Target Synonyms | BOP; BOR; BOS1; OFC1; EYA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, Mouse testis, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human EYA1 (NP_000494.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD | Uniprot ID | Q99502 |
Uniprot Id
Q99502
Target Species
Human
Target Name
EYA1
Target Full Name
Protein phosphatase EYA1
Target Function
Functions both as protein phosphatase and as transcriptional coactivator for SIX1, and probably also for SIX2, SIX4 and SIX5. Tyrosine phosphatase that dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph) and promotes efficient DNA repair via the recruitment of DNA repair complexes containing MDC1. 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Its function as histone phosphatase may contribute to its function in transcription regulation during organogenesis. Has also phosphatase activity with proteins phosphorylated on Ser and Thr residues (in vitro). Required for normal embryonic development of the craniofacial and trunk skeleton, kidneys and ears. Together with SIX1, it plays an important role in hypaxial muscle development; in this it is functionally redundant with EYA2.
Target Involvement
Branchiootorenal syndrome 1 (BOR1); Otofaciocervical syndrome 1 (OTFCS1); Branchiootic syndrome 1 (BOS1); Anterior segment anomalies with or without cataract (ASA)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
HAD-like hydrolase superfamily, EYA family
Target Tissue Specificity
In the embryo, highly expressed in kidney with lower levels in brain. Weakly expressed in lung. In the adult, highly expressed in heart and skeletal muscle. Weakly expressed in brain and liver. No expression in eye or kidney.
Target Synonyms
BOP; BOR; BOS1; EYA transcriptional coactivator and phosphatase 1; Eya1; EYA1_HUMAN; Eyes absent 1; Eyes absent 1 homolog; Eyes absent homolog 1 (Drosophila); Eyes absent homolog 1; Eyes absent homolog1; MGC141875; OFC1
Target Background
This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator. Alternatively spliced transcript variants have been identified for this gene.
Notification