-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Fascin/FSCN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 394-493 of human Fascin/Fascin/FSCN1 (NP_003079.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Fascin/FSCN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 394-493 of human Fascin/Fascin/FSCN1 (NP_003079.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16708A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Fascin/FSCN1 |
| Target Synonyms | HSN; SNL; p55; FAN1; N1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Mouse brain, Mouse spinal cord, NCI-H460, SH-SY5Y, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 394-493 of human Fascin/Fascin/FSCN1 (NP_003079.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FIGCRKVTGTLDANRSSYDVFQLEFNDGAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDPASLWEY | Uniprot ID | Q16658 |
Uniprot Id
Q16658
Target Species
Human
Target Name
FSCN1
Target Full Name
Fascin
Target Function
Actin-binding protein that contains 2 major actin binding sites. Organizes filamentous actin into parallel bundles. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration. Mediates reorganization of the actin cytoskeleton and axon growth cone collapse in response to NGF.
Target Subcellular Location
Cytoplasm, cytosol. Cytoplasm, cell cortex. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, stress fiber. Cell projection, filopodium. Cell projection, invadopodium. Cell projection, microvillus. Cell junction.
Target Protein Families
Fascin family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
55 kDa actin bundling protein; 55 kDa actin-bundling protein; Actin bundling protein; actin bundling protein; 55-KD; FAN 1; FAN1; Fascin 1; Fascin actin bundling protein 1; Fascin; Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus); Fascin homolog 1; Fascin; sea urchin; homolog of; 1; Fascin1; FLJ38511; FSCN 1; FSCN1; FSCN1_HUMAN; HSN; p55; Singed (Drosophila) like (sea urchin fascin homolog like); Singed drosophila homolog like; Singed like (fascin homolog sea urchin) (Drosophila); Singed like (fascin homolog sea urchin); Singed like protein; Singed; drosophila; homolog of; Singed-like protein; SNL; Strongylocentrotus purpuratus
Target Background
This gene encodes a member of the fascin family of actin-binding proteins. Fascin proteins organize F-actin into parallel bundles, and are required for the formation of actin-based cellular protrusions. The encoded protein plays a critical role in cell migration, motility, adhesion and cellular interactions. Expression of this gene is known to be regulated by several microRNAs, and overexpression of this gene may play a role in the metastasis of multiple types of cancer by increasing cell motility. Expression of this gene is also a marker for Reed-Sternberg cells in Hodgkin's lymphoma. A pseudogene of this gene is located on the long arm of chromosome 15.
Notification