Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FASTKD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 51-150 of human FASTKD2(NP_055744.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FASTKD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 51-150 of human FASTKD2(NP_055744.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08538A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FASTKD2 |
| Target Synonyms | COXPD44; KIAA0971 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 51-150 of human FASTKD2(NP_055744.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PKIVHSNWNILNNFHNRMQSTDIIRYLFQDAFIFKSDVGFQTKGISTLTALRIERLLYAKRLFFDSKQSLVPVDKSDDELKKVNLNHEVSNEDVLTKETK | Uniprot ID | Q9NYY8 |
Uniprot Id
Q9NYY8
Target Species
Human
Target Name
FASTKD2
Target Full Name
FAST kinase domain-containing protein 2, mitochondrial
Target Function
Plays an important role in assembly of the mitochondrial large ribosomal subunit. As a component of a functional protein-RNA module, consisting of RCC1L, NGRN, RPUSD3, RPUSD4, TRUB2, FASTKD2 and 16S mitochondrial ribosomal RNA (16S mt-rRNA), controls 16S mt-rRNA abundance and is required for intra-mitochondrial translation. May play a role in mitochondrial apoptosis.
Target Subcellular Location
Mitochondrion matrix, mitochondrion nucleoid. Mitochondrion matrix.
Target Protein Families
FAST kinase family
Target Tissue Specificity
Expression detected in spleen, thymus, testis, ovary, colon, heart, smooth muscle, kidney, brain, lung, liver and white adipose tissue with highest expression in heart, smooth muscle and thyroid.
Target Synonyms
FAKD2_HUMAN; FAST kinase domain containing protein 2; FAST kinase domain-containing protein 2; FAST kinase domains 2; Fastkd2; KIAA0971
Target Background
This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
