-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FCGR2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 241-310 of human FCGR2B (NP_003992.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FCGR2B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 241-310 of human FCGR2B (NP_003992.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02433A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FCGR2B |
| Target Synonyms | CD32; FCG2; CD32B; FCGR2; IGFR2; FCGR2C; FcGRIIB; FcRII-c; FcgammaRIIb; FCGR2B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human placenta | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 241-310 of human FCGR2B (NP_003992.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI | Uniprot ID | P31994 |
Uniprot Id
P31994
Target Species
Human
Target Name
FCGR2B
Target Full Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Target Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis.
Target Involvement
Systemic lupus erythematosus (SLE)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cells.
Target Research Area
Immunology
Target Synonyms
FCGR2B; CD32; FCG2; IGFR2; Low affinity immunoglobulin gamma Fc region receptor II-b; IgG Fc receptor II-b; CDw32; Fc-gamma RII-b; Fc-gamma-RIIb; FcRII-b; CD antigen CD32
Target Background
The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene.
Notification