-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FCGR3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human FCGR3A (NP_000560.7) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FCGR3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human FCGR3A (NP_000560.7) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11290A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FCGR3A |
| Target Synonyms | CD16; FCG3; CD16A; FCGR3; IGFR3; IMD20; FCR-10; FCRIII; CD16-II; FCGRIII; FCRIIIA; FcGRIIIA; FCGR3A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse liver, Mouse testis, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human FCGR3A (NP_000560.7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD | Uniprot ID | P08637 |
Uniprot Id
P08637
Target Species
Human
Target Name
FCGR3A
Target Full Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Target Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Target Involvement
Immunodeficiency 20 (IMD20)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Secreted. Note=Exists also as a soluble receptor.
Target Tissue Specificity
Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
Target Research Area
Immunology
Target Synonyms
FCGR3A; CD16A; FCG3; FCGR3; IGFR3; Low affinity immunoglobulin gamma Fc region receptor III-A; CD16a antigen; Fc-gamma RIII-alpha; Fc-gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc receptor III-2; CD antigen CD16a
Target Background
This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody dependent enhancement of virus infections. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene are associated with immunodeficiency 20, and have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification