-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FKBP12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 29-108 of human FKBP12 (P62942) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FKBP12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 29-108 of human FKBP12 (P62942) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13769A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FKBP12 |
| Target Synonyms | FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Rat heart, Mouse brain, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 29-108 of human FKBP12 (P62942). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE | Uniprot ID | P62942 |
Uniprot Id
P62942
Target Species
Human
Target Name
FKBP1A
Target Full Name
Peptidyl-prolyl cis-trans isomerase FKBP1A
Target Function
Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Target Subcellular Location
Cytoplasm, cytosol. Sarcoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
FKBP-type PPIase family, FKBP1 subfamily
Target Research Area
Immunology
Target Synonyms
12 kDa FK506-binding protein; 12 kDa FKBP; Calstabin 1; FK506 binding protein 1; FK506 binding protein 12; FK506 binding protein 1A (12kD); FK506 binding protein 1A 12kDa; FK506 binding protein 1A; FK506 binding protein T cell 12 kD; FK506 binding protein; T cell; 12 kD; FK506 binding protein12; FK506-binding protein 1A; FKB1A_HUMAN; FKBP 12; FKBP 1A; FKBP-12; FKBP-1A; FKBP1; FKBP12; FKBP12 Exip3; FKBP12C; fkbp1a; Immunophilin FKBP12; Peptidyl prolyl cis trans isomerase; Peptidyl-prolyl cis-trans isomerase FKBP1A; PKC12; PKCI2; PPIase; PPIase FKBP1A; Protein kinase C inhibitor 2; Rotamase
Target Background
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed.
Notification