-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FKBP51/FKBP5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-457 of human FKBP51/FKBP5 (Q13451) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FKBP51/FKBP5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-457 of human FKBP51/FKBP5 (Q13451) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14191A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FKBP51/FKBP5 |
| Target Synonyms | P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10; FKBP51/FKBP5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-1080, Mouse testis, Rat testis, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-457 of human FKBP51/FKBP5 (Q13451). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV | Uniprot ID | Q13451 |
Uniprot Id
Q13451
Target Species
Human
Target Name
FKBP5
Target Full Name
Peptidyl-prolyl cis-trans isomerase FKBP5
Target Function
Immunophilin protein with PPIase and co-chaperone activities. Component of unligated steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). Plays a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors maintaining the complex into the cytoplasm when unliganded. Acts as a regulator of Akt/AKT1 activity by promoting the interaction between Akt/AKT1 and PHLPP1, thereby enhancing dephosphorylation and subsequent activation of Akt/AKT1.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Widely expressed, enriched in testis compared to other tissues.
Target Synonyms
51 kDa FK506 binding protein 5; 51 kDa FK506 binding protein; 51 kDa FK506-binding protein; 51 kDa FKBP; 54 kDa progesterone receptor associated immunophilin; 54 kDa progesterone receptor-associated immunophilin; AIG 6; AIG6; Androgen regulated protein 6; Androgen-regulated protein 6; FF1 antigen; FK506 binding protein 5; FK506-binding protein 5; FKBP 5; FKBP 51; FKBP 54; FKBP-5; FKBP-51; FKBP5; FKBP5_HUMAN; FKBP54; HSP90 binding immunophilin; HSP90-binding immunophilin; MGC111006; OTTHUMP00000016268; P54; Peptidyl prolyl cis trans isomerase; Peptidyl-prolyl cis-trans isomerase FKBP5; Peptidylprolyl cis trans isomerase; PPIase; PPIase FKBP5; Ptg 10; Ptg10; Rotamase; T cell FK506 binding protein
Target Background
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.
Notification