-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXP1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 550-650 of human FOXP1 (Q9H334) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FOXP1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 550-650 of human FOXP1 (Q9H334) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13906A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXP1 |
| Target Synonyms | MFH; QRF1; 12CC4; hFKH1B; HSPC215; FOXP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-549, Jurkat, Mouse brain, Mouse spleen, Rat lung, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 550-650 of human FOXP1 (Q9H334). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPLDPEEAEGPLS | Uniprot ID | Q9H334 |
Uniprot Id
Q9H334
Target Species
Human
Target Name
FOXP1
Target Full Name
Forkhead box protein P1
Target Function
Transcriptional repressor. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal chord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in embryonic stem cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T(FH)s. Involved in maintenance of hair follicle stem cell quiescence; the function probably involves regulation of FGF18. Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis. Binds to CSF1R promoter elements and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes seems to involve NCOR2 as corepressor. Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization seems to implicate suppression of SEMA5B. Can negatively regulate androgen receptor signaling. Acts as a transcriptional activator of the FBXL7 promoter; this activity is regulated by AURKA.; Involved in transcriptional regulation in embryonic stem cells (ESCs). Stimulates expression of transcription factors that are required for pluripotency and decreases expression of differentiation-associated genes. Has distinct DNA-binding specifities as compared to the canonical form and preferentially binds DNA with the sequence 5'-CGATACAA-3' (or closely related sequences). Promotes ESC self-renewal and pluripotency.
Target Involvement
Mental retardation with language impairment and autistic features (MRLIAF)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Isoform 8 is specifically expressed in embryonic stem cells.
Target Research Area
Transcription
Target Synonyms
12CC4; FLJ23741; Fork head related protein like B; Forkhead box P1; Forkhead box protein P1; FOX P1; FOXP 1; foxp1; FOXP1_HUMAN; Glutamine rich factor 1; hFKH1B; HSPC215; MGC12942; MGC88572; MGC99551; QRF 1; QRF1
Target Background
This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification