Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABARAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (NP_009209.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GABARAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (NP_009209.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05985A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABARAP |
| Target Synonyms | MM46; ATG8A; GABARAP-a; GABARAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat kidney, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (NP_009209.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE | Uniprot ID | O95166 |
Uniprot Id
O95166
Target Species
Human
Target Name
GABARAP
Target Full Name
Gamma-aminobutyric acid receptor-associated protein
Target Function
Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in autophagy: while LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover. Also required for the local activition of the CUL3(KBTBD6/7) E3 ubiquitin ligase complex, regulating ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor (GEF) that activates RAC1 and downstream signal transduction. Thereby, regulates different biological processes including the organization of the cytoskeleton, cell migration and proliferation. Involved in apoptosis.
Target Subcellular Location
Endomembrane system. Cytoplasm, cytoskeleton. Golgi apparatus membrane. Cytoplasmic vesicle, autophagosome. Cytoplasmic vesicle.
Target Protein Families
ATG8 family
Target Tissue Specificity
Heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.
Target Research Area
Transport
Target Synonyms
ATG8A; FLC 3B; FLC3B; FLJ25768; GABA type A receptor associated protein; GABA(A) receptor associated protein; GABA(A) receptor-associated protein; GABARAP a; GABARAP; Gamma aminobutyric acid receptor associated protein; Gamma-aminobutyric acid receptor-associated protein; GBRAP_HUMAN; MGC120154; MGC120155; MM 46; MM46
Target Background
Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
