Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GEM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human GEM (NP_005252.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GEM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human GEM (NP_005252.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02512A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GEM |
| Target Synonyms | KIR; GEM | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human GEM (NP_005252.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVG | Uniprot ID | P55040 |
Uniprot Id
P55040
Target Species
Human
Target Name
GEM
Target Full Name
GTP-binding protein GEM
Target Function
Could be a regulatory protein, possibly participating in receptor-mediated signal transduction at the plasma membrane. Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity.
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Small GTPase superfamily, RGK family
Target Tissue Specificity
Most abundant in thymus, spleen, kidney, lung, and testis. Less abundant in heart, brain, liver and skeletal muscle.
Target Synonyms
GEM; KIRGTP-binding protein GEM; GTP-binding mitogen-induced T-cell protein; RAS-like protein KIR
Target Background
The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
