-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GGT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 370-569 of human GGT1 (NP_038265.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GGT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 370-569 of human GGT1 (NP_038265.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04507A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GGT1 |
| Target Synonyms | GGT; GTG; GGTD; CD224; GGT 1; D22S672; D22S732; GGT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 370-569 of human GGT1 (NP_038265.2?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY | Uniprot ID | P19440 |
Uniprot Id
P19440
Target Species
Human
Target Name
GGT1
Target Full Name
Glutathione hydrolase 1 proenzyme
Target Function
Cleaves the gamma-glutamyl bond of extracellular glutathione (gamma-Glu-Cys-Gly), glutathione conjugates and other gamma-glutamyl compounds, such as leukotriene C4 (LTC4). The metabolism of glutathione by GGT1 releases free glutamate and the dipeptide cysteinyl-glycine, which is hydrolyzed to cysteine and glycine by dipeptidases. In the presence of high concentrations of dipeptides and some amino acids, can also catalyze a transpeptidation reaction, transferring the gamma-glutamyl moiety to an acceptor amino acid to form a new gamma-glutamyl compound. Contributes to cysteine homeostasis, glutathione homeostasis and in the conversion of the leukotriene LTC4 to LTD4.; Seems to be inactive.
Target Involvement
Glutathionuria (GLUTH)
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Target Protein Families
Gamma-glutamyltransferase family
Target Tissue Specificity
Detected in fetal and adult kidney and liver, adult pancreas, stomach, intestine, placenta and lung. There are several other tissue-specific forms that arise from alternative promoter usage but that produce the same protein.; [Isoform 3]: Lung-specific.
Target Synonyms
GGT1; GGT; Glutathione hydrolase 1 proenzyme; Gamma-glutamyltransferase 1; Gamma-glutamyltranspeptidase 1; GGT 1; Leukotriene-C4 hydrolase; CD antigen CD224
Target Background
The enzyme encoded by this gene is a type I gamma-glutamyltransferase that catalyzes the transfer of the glutamyl moiety of glutathione to a variety of amino acids and dipeptide acceptors. The enzyme is composed of a heavy chain and a light chain, which are derived from a single precursor protein. It is expressed in tissues involved in absorption and secretion and may contribute to the etiology of diabetes and other metabolic disorders. Multiple alternatively spliced variants have been identified. There are a number of related genes present on chromosomes 20 and 22, and putative pseudogenes for this gene on chromosomes 2, 13, and 22.
Notification