Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GIGYF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human GIGYF2 (NP_001096617.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GIGYF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human GIGYF2 (NP_001096617.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02155A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GIGYF2 |
| Target Synonyms | GYF2; PERQ2; PERQ3; PARK11; TNRC15; GIGYF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human GIGYF2 (NP_001096617.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VDEGEECSDSEGSHNEEAKEPDKTNKKEGEKTDRVGVASEETPQTSSSSARPGTPSDHQSQEASQFERKDEPKTEQTEKAEEETRMENSLPAKVPSRGDEMVADVQQPLSQIPSDTASPLLILPPPVPNPSPTLRPVETPVVGAPGMGSVS | Uniprot ID | Q6Y7W6 |
Uniprot Id
Q6Y7W6
Target Species
Human
Target Name
GIGYF2
Target Full Name
GRB10-interacting GYF protein 2
Target Function
Key component of the 4EHP-GYF2 complex, a multiprotein complex that acts as a repressor of translation initiation. In the 4EHP-GYF2 complex, acts as a factor that bridges EIF4E2 to ZFP36/TTP, linking translation repression with mRNA decay. Also recruits and bridges the association of the 4EHP complex with the decapping effector protein DDX6, which is required for the ZFP36/TTP-mediated down-regulation of AU-rich mRNA. May act cooperatively with GRB10 to regulate tyrosine kinase receptor signaling, including IGF1 and insulin receptors.
Target Involvement
Parkinson disease 11 (PARK11)
Target Protein Families
GIGYF family
Target Research Area
Signal Transduction
Target Synonyms
GIGYF2; KIAA0642; PERQ2; TNRC15GRB10-interacting GYF protein 2; PERQ amino acid-rich with GYF domain-containing protein 2; Trinucleotide repeat-containing gene 15 protein
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
