-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GIT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-510 of human GIT2 (NP_476511.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GIT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 450-510 of human GIT2 (NP_476511.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05108A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GIT2 |
| Target Synonyms | PKL; CAT2; CAT-2; GIT2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, Jurkat, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 450-510 of human GIT2 (NP_476511.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASRLEKQNSTPESDYDNTPNDMEPDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLP | Uniprot ID | Q14161 |
Uniprot Id
Q14161
Target Species
Human
Target Name
GIT2
Target Full Name
ARF GTPase-activating protein GIT2
Target Function
GTPase-activating protein for ADP ribosylation factor family members, including ARF1.
Target Synonyms
ARF GAP GIT2; ARF GTPase activating protein GIT2; ARF GTPase-activating protein GIT2; CAT 2; CAT-2; CAT2; Cool associated tyrosine phosphorylated protein 2; Cool interacting tyrosine phosphorylated protein 2; Cool-interacting tyrosine-phosphorylated protein 2; DKFZp686G01261; G protein coupled receptor kinase interacting ArfGAP 2; G protein coupled receptor kinase interactor 2; G protein-coupled receptor kinase-interactor 2; GIT 2; GIT2; GIT2_HUMAN; GRK interacting protein 2; GRK-interacting protein 2; KIAA0148; MGC760
Target Background
This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding.
Notification