Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GJA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 229-333 of human GJA4 (NP_002051.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GJA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 229-333 of human GJA4 (NP_002051.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09871A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GJA4 |
| Target Synonyms | CX37; GJA4 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 229-333 of human GJA4 (NP_002051.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV | Uniprot ID | P35212 |
Uniprot Id
P35212
Target Species
Human
Target Name
GJA4
Target Full Name
Gap junction alpha-4 protein
Target Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Target Protein Families
Connexin family, Alpha-type (group II) subfamily
Target Tissue Specificity
Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium.
Target Synonyms
GJA4; Gap junction alpha-4 protein; Connexin-37; Cx37
Target Background
This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
