Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GJB3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GJB3 (NP_076872.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GJB3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GJB3 (NP_076872.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04230A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GJB3 |
| Target Synonyms | EKV; CX31; DFNA2; EKVP1; DFNA2B; GJB3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse intestine, Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GJB3 (NP_076872.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIV | Uniprot ID | O75712 |
Uniprot Id
O75712
Target Species
Human
Target Name
GJB3
Target Full Name
Gap junction beta-3 protein
Target Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Target Involvement
Erythrokeratodermia variabilis et progressiva 1 (EKVP1); Deafness, autosomal dominant, 2B (DFNA2B)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Target Protein Families
Connexin family, Beta-type (group I) subfamily
Target Synonyms
GJB3; CX31; Gap junction beta-3 protein; Connexin-31; Cx31
Target Background
This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene can cause non-syndromic deafness or erythrokeratodermia variabilis, a skin disorder. Alternative splicing results in multiple transcript variants encoding the same protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
