Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human GLO1 (NP_006699.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GLO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human GLO1 (NP_006699.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04457A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLO1 |
| Target Synonyms | GLYI; GLOD1; HEL-S-74; GLO1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 22Rv1, BT-474, PC-3, U-937 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human GLO1 (NP_006699.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM | Uniprot ID | Q04760 |
Uniprot Id
Q04760
Target Species
Human
Target Name
GLO1
Target Full Name
Lactoylglutathione lyase
Target Function
Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. Required for normal osteoclastogenesis.
Target Protein Families
Glyoxalase I family
Target Research Area
Signal Transduction
Target Synonyms
Aldoketomutase; glo1; GLOD1; Glx I; GLYI; glyoxalase domain containing 1; Glyoxalase I; Ketone aldehyde mutase ; Ketone-aldehyde mutase; Lactoyl glutathione lyase ; Lactoylglutathione lyase; LGUL_HUMAN; Methylglyoxalase; S D lactoylglutathione methylglyoxal lyase ; S-D-lactoylglutathione methylglyoxal lyase
Target Background
The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
