Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Glycerol kinase (GK) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-559 of human Glycerol kinase (GK) (P32189) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Glycerol kinase (GK) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-559 of human Glycerol kinase (GK) (P32189) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14385A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Glycerol kinase (GK) |
| Target Synonyms | GK1; GKD; Glycerol kinase (GK) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse testis, Rat kidney, Rat liver, Rat testis, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-559 of human Glycerol kinase (GK) (P32189). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP | Uniprot ID | P32189 |
Uniprot Id
P32189
Target Species
Human
Target Name
GK
Target Full Name
Glycerol kinase
Target Function
Key enzyme in the regulation of glycerol uptake and metabolism.
Target Involvement
Glycerol kinase deficiency (GKD)
Target Subcellular Location
Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm. Note=In sperm and fetal tissues, the majority of the enzyme is bound to mitochondria, but in adult tissues, such as liver found in the cytoplasm.
Target Protein Families
FGGY kinase family
Target Tissue Specificity
Highly expressed in the liver, kidney and testis. Isoform 2 and isoform 3 are expressed specifically in testis and fetal liver, but not in the adult liver.
Target Synonyms
ATP glycerol 3 phosphotransferase; ATP:glycerol 3 phosphotransferase; ATP:glycerol 3-phosphotransferase; D930012N15Rik; GK; GK1; GKD; GLPK_HUMAN; Glycerokinase; Glycerol kinase; OTTHUMP00000023108; OTTHUMP00000023109; OTTHUMP00000215321
Target Background
The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
