-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNAT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 58-178 of human GNAT1 (NP_000163.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNAT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 58-178 of human GNAT1 (NP_000163.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11560A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNAT1 |
| Target Synonyms | GBT1; HG1F; GNATR; CSNB1G; CSNBAD3; GNAT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 58-178 of human GNAT1 (NP_000163.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFERASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTT | Uniprot ID | P11488 |
Uniprot Id
P11488
Target Species
Human
Target Name
GNAT1
Target Full Name
Guanine nucleotide-binding protein G(t) subunit alpha-1
Target Function
Functions as signal transducer for the rod photoreceptor RHO. Required for normal RHO-mediated light perception by the retina. Guanine nucleotide-binding proteins (G proteins) function as transducers downstream of G protein-coupled receptors (GPCRs), such as the photoreceptor RHO. The alpha chain contains the guanine nucleotide binding site and alternates between an active, GTP-bound state and an inactive, GDP-bound state. Activated RHO promotes GDP release and GTP binding. Signaling is mediated via downstream effector proteins, such as cGMP-phosphodiesterase.
Target Involvement
Night blindness, congenital stationary, autosomal dominant 3 (CSNBAD3); Night blindness, congenital stationary, 1G (CSNB1G)
Target Subcellular Location
Cell projection, cilium, photoreceptor outer segment. Membrane; Peripheral membrane protein. Photoreceptor inner segment.
Target Protein Families
G-alpha family, G(i/o/t/z) subfamily
Target Tissue Specificity
Rod photoreceptor cells. Predominantly expressed in the retina followed by the ciliary body, iris and retinal pigment epithelium.
Target Synonyms
CSNBAD3; GBT1; GNAT1; GNAT1_HUMAN; GNATR; guanine nucleotide binding protein (G protein) alpha transducing activity polypeptide 1; guanine nucleotide binding protein G(T) alpha 1 subunit ; Guanine nucleotide-binding protein G(t) subunit alpha-1; Rod specific transducin; rod-type transducin alpha subunit; Transducin alpha-1 chain; transducin; rod-specific
Target Background
Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in rods. This gene is also expressed in other cells, and has been implicated in bitter taste transduction in rat taste cells. Mutations in this gene result in autosomal dominant congenital stationary night blindness. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Notification