Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GOLGB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1704-1797 of human GOLGB1 (NP_004478.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GOLGB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1704-1797 of human GOLGB1 (NP_004478.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07453A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GOLGB1 |
| Target Synonyms | GCP; GCP372; GOLIM1; GOLGB1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1704-1797 of human GOLGB1 (NP_004478.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HPAGDTAKECMETLLSSNASMKEELERVKMEYETLSKKFQSLMSEKDSLSEEVQDLKHQIEGNVSKQANLEATEKHDNQTNVTEEGTQSIPGET | Uniprot ID | Q14789 |
Uniprot Id
Q14789
Target Species
Human
Target Name
GOLGB1
Target Full Name
Golgin subfamily B member 1
Target Function
May participate in forming intercisternal cross-bridges of the Golgi complex.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type I membrane protein.
Target Synonyms
372 kDa Golgi complex associated protein; 372 kDa Golgi complex-associated protein; GCP; GCP372; Giantin; GOGB1_HUMAN; GOLGB1; Golgi autoantigen golgin subfamily a member 1; Golgi autoantigen golgin subfamily b macrogolgin (with transmembrane signal) 1 ; Golgi autoantigen, golgin subfamily b, macrogolgin 1; Golgi complex associated protein 372kDa; Golgi complex-associated protein 372kDa; Golgin B1; Golgin B1, golgi integral membrane protein; Golgin subfamily B member 1; GOLIM1; Macrogolgin; MGC33154
Target Background
Enables RNA binding activity. Involved in protein localization to pericentriolar material. Located in Golgi apparatus and endoplasmic reticulum-Golgi intermediate compartment.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
