-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GOLPH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human GOLPH2 (Q8NBJ4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GOLPH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human GOLPH2 (Q8NBJ4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14088A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GOLPH2 |
| Target Synonyms | GP73; HEL46; GOLPH2; C9orf155; PSEC0257; bA379P1.3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Mouse lung, Mouse spleen, Mouse stomach, Rat lung, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GOLPH2 (Q8NBJ4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD | Uniprot ID | Q8NBJ4 |
Uniprot Id
Q8NBJ4
Target Species
Human
Target Name
GOLM1
Target Full Name
Golgi membrane protein 1
Target Function
Unknown. Cellular response protein to viral infection.
Target Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Single-pass type II membrane protein. Note=Early Golgi. Cycles via the cell surface and endosomes upon lumenal pH disruption.
Target Protein Families
GOLM1/CASC4 family
Target Tissue Specificity
Widely expressed. Highly expressed in colon, prostate, trachea and stomach. Expressed at lower level in testis, muscle, lymphoid tissues, white blood cells and spleen. Predominantly expressed by cells of the epithelial lineage. Expressed at low level in n
Target Research Area
Signal Transduction
Target Synonyms
bA379P1.3; C9orf155; Chromosome 9 open reading frame 155; Golgi membrane protein 1; Golgi membrane protein GP73; Golgi phosphoprotein 2; Golgi protein 73 kD ; Golgi protein 73kD ; GOLM 1; GOLM1; GOLM1_HUMAN; GOLPH 2; GOLPH2; GP 73; GP73; PSEC0257
Target Background
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene.
Notification