-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPIHBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-151 of human GPIHBP1 (NP_835466.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPIHBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-151 of human GPIHBP1 (NP_835466.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03547A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPIHBP1 |
| Target Synonyms | HYPL1D; GPI-HBP1; GPIHBP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-151 of human GPIHBP1 (NP_835466.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTG | Uniprot ID | Q8IV16 |
Uniprot Id
Q8IV16
Target Species
Human
Target Name
GPIHBP1
Target Full Name
Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
Target Function
Mediates the transport of lipoprotein lipase LPL from the basolateral to the apical surface of endothelial cells in capillaries. Anchors LPL on the surface of endothelial cells in the lumen of blood capillaries. Protects LPL against loss of activity, and against ANGPTL4-mediated unfolding. Thereby, plays an important role in lipolytic processing of chylomicrons by LPL, triglyceride metabolism and lipid homeostasis. Binds chylomicrons and phospholipid particles that contain APOA5. Binds high-density lipoprotein (HDL) and plays a role in the uptake of lipids from HDL.
Target Involvement
Hyperlipoproteinemia 1D (HLPP1D)
Target Subcellular Location
Apical cell membrane; Lipid-anchor, GPI-anchor. Basolateral cell membrane; Lipid-anchor, GPI-anchor. Cell membrane; Lipid-anchor, GPI-anchor.
Target Synonyms
GPIHBP1; HBP1; Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-HBP1; GPI-anchored HDL-binding protein 1; High density lipoprotein-binding protein 1
Target Background
This gene encodes a capillary endothelial cell protein that facilitates the lipolytic processing of triglyceride-rich lipoproteins. The encoded protein is a glycosylphosphatidylinositol-anchored protein that is a member of the lymphocyte antigen 6 (Ly6) family. This protein plays a major role in transporting lipoprotein lipase (LPL) from the subendothelial spaces to the capillary lumen. Mutations in this gene are the cause of hyperlipoproteinemia, type 1D. Alternate splicing results in multiple transcript variants.
Notification