Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR128 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-135 of human GPR128 (NP_116176.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR128 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-135 of human GPR128 (NP_116176.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05645A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR128 |
| Target Synonyms | GPR128 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 27-135 of human GPR128 (NP_116176.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGIWRIVIRIQRGKSTSSSSTPTEFCRNGGTWENGRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRLCSLSLYGEIELQKVT | Uniprot ID | Q96K78 |
Uniprot Id
Q96K78
Target Species
Human
Target Name
ADGRG7
Target Full Name
Adhesion G-protein coupled receptor G7
Target Function
Orphan receptor.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Target Synonyms
ADGRG7; GPR128; Adhesion G-protein coupled receptor G7; G-protein coupled receptor 128
Target Background
Predicted to enable G protein-coupled receptor activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
