Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRID1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 880-1009 of human GRID1 (NP_060021.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GRID1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 880-1009 of human GRID1 (NP_060021.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01823A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRID1 |
| Target Synonyms | GluD1; GluD1-b; GRID1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat spinal cord | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 880-1009 of human GRID1 (NP_060021.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNSLMDEDIAHKQISPASIELSALEMGGLAPTQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI | Uniprot ID | Q9ULK0 |
Uniprot Id
Q9ULK0
Target Species
Human
Target Name
GRID1
Target Full Name
Glutamate receptor ionotropic, delta-1
Target Function
Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Target Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, GRID1 subfamily
Target Synonyms
GRID1; KIAA1220Glutamate receptor ionotropic; delta-1; GluD1; GluR delta-1 subunit
Target Background
This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
