Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human GRK1 (NP_002920.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GRK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human GRK1 (NP_002920.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12019A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRK1 |
| Target Synonyms | RK; RHOK; GPRK1; GRK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Y79 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human GRK1 (NP_002920.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQA | Uniprot ID | Q15835 |
Uniprot Id
Q15835
Target Species
Human
Target Name
GRK1
Target Full Name
Rhodopsin kinase GRK1
Target Function
Retina-specific kinase involved in the signal turnoff via phosphorylation of rhodopsin (RHO), the G protein- coupled receptor that initiates the phototransduction cascade. This rapid desensitization is essential for scotopic vision and permits rapid adaptation to changes in illumination. May play a role in the maintenance of the outer nuclear layer in the retina.
Target Involvement
Night blindness, congenital stationary, Oguchi type 2 (CSNBO2)
Target Subcellular Location
Membrane; Lipid-anchor. Cell projection, cilium, photoreceptor outer segment.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, GPRK subfamily
Target Tissue Specificity
Retinal-specific. Expressed in rods and cones cells.
Target Synonyms
EC=2.7.11.14; G protein-coupled receptor kinase 1; GPRK1; Grk1; Rhodopsin kinase; RHOK; RK; RK_HUMAN
Target Background
This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
