-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Grp75/MOT/HSPA9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 580-679 of human Grp75/MOT/HSPA9 (P38646) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Grp75/MOT/HSPA9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 580-679 of human Grp75/MOT/HSPA9 (P38646) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16716A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Grp75/MOT/HSPA9 |
| Target Synonyms | CSA; MOT; MOT2; SAAN; CRP40; EVPLS; GRP75; PBP74; GRP-75; HSPA9B; SIDBA4; MTHSP75; HEL-S-124m; Grp75/MOT/HSPA9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, HepG2, MCF7, Mouse brain, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 580-679 of human Grp75/MOT/HSPA9 (P38646). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ | Uniprot ID | P38646 |
Uniprot Id
P38646
Target Species
Human
Target Name
HSPA9
Target Full Name
Stress-70 protein, mitochondrial
Target Function
Chaperone protein which plays an important role in mitochondrial iron-sulfur cluster (ISC) biogenesis. Interacts with and stabilizes ISC cluster assembly proteins FXN, NFU1, NFS1 and ISCU. Regulates erythropoiesis via stabilization of ISC assembly. May play a role in the control of cell proliferation and cellular aging.
Target Involvement
Anemia, sideroblastic, 4 (SIDBA4); Even-plus syndrome (EVPLS)
Target Subcellular Location
Mitochondrion. Nucleus, nucleolus.
Target Protein Families
Heat shock protein 70 family
Target Synonyms
75 kDa glucose regulated protein; 75 kDa glucose-regulated protein; CSA; Glucose Regulated Protein; Grp 75; GRP-75; GRP75; GRP75_HUMAN; Heat shock 70 kDa protein 9; Heat shock 70kD protein 9; heat shock 70kDa protein 9; Heat shock 70kDa protein 9B; Heat shock protein 74 kDa A; Heat shock protein A; Heat shock protein cognate 74; Hsc74; Hsp74; Hsp74a; HSPA9; Hspa9a; HSPA9B; MGC4500; mitochondrial; Mortalin 2; Mortalin; Mortalin perinuclear; Mortalin2; MOT 2; MOT; MOT2; Mthsp70; p66 mortalin; P66 MOT; PBP74; Peptide binding protein 74; Peptide-binding protein 74; Stress 70 protein mitochondrial; Stress 70 protein mitochondrial precursor; Stress-70 protein
Target Background
This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cognate protein. This protein plays a role in cell proliferation, stress response and maintenance of the mitochondria. A pseudogene of this gene is found on chromosome 2.
Notification