-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Grp94 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human Grp94 (NP_003290.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Grp94 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human Grp94 (NP_003290.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07796A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Grp94 |
| Target Synonyms | ECGP; GP96; TRA1; GRP94; HEL35; HEL-S-125m; Grp94 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, A-375, L-O2, Mouse liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human Grp94 (NP_003290.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRR | Uniprot ID | P14625 |
Uniprot Id
P14625
Target Species
Human
Target Name
HSP90B1
Target Full Name
Endoplasmin
Target Function
Molecular chaperone that functions in the processing and transport of secreted proteins. When associated with CNPY3, required for proper folding of Toll-like receptors. Functions in endoplasmic reticulum associated degradation (ERAD). Has ATPase activity. May participate in the unfolding of cytosolic leaderless cargos (lacking the secretion signal sequence) such as the interleukin 1/IL-1 to facilitate their translocation into the ERGIC (endoplasmic reticulum-Golgi intermediate compartment) and secretion; the translocation process is mediated by the cargo receptor TMED10.
Target Subcellular Location
Endoplasmic reticulum lumen. Sarcoplasmic reticulum lumen. Melanosome.
Target Protein Families
Heat shock protein 90 family
Target Research Area
Metabolism
Target Synonyms
94 kDa glucose regulated protein; 94 kDa glucose-regulated protein; ECGP; Endoplasmin; Endothelial cell (HBMEC) glycoprotein; ENPL_HUMAN; Glucose regulated protein 94kDa; gp96; gp96 homolog; GRP 94; GRP-94; Heat shock protein 90 kDa beta member 1; heat shock protein 90kDa beta (Grp94); member 1; Heat shock protein; 90 kDa; beta; 1; HSP90B1; Stress inducible tumor rejection antigen GP96; TRA1; tumor rejection antigen (gp96) 1; Tumor rejection antigen 1; Tumor rejection antigen gp96; Tumor rejection antigen-1 (gp96)
Target Background
This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this protein is associated with a variety of pathogenic states, including tumor formation. There is a microRNA gene located within the 5' exon of this gene. There are pseudogenes for this gene on chromosomes 1 and 15.
Notification