Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HBD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human HBD (NP_000510.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HBD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human HBD (NP_000510.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01022A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HBD |
| Target Synonyms | HBD | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human HBD (NP_000510.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH | Uniprot ID | P02042 |
Uniprot Id
P02042
Target Species
Human
Target Name
HBD
Target Full Name
Hemoglobin subunit delta
Target Function
Involved in oxygen transport from the lung to the various peripheral tissues.
Target Protein Families
Globin family
Target Tissue Specificity
Red blood cells.
Target Research Area
Transport
Target Synonyms
Delta-globin; HBD; HBD_HUMAN; Hemoglobin delta chain; Hemoglobin subunit delta
Target Background
The delta (HBD) and beta (HBB) genes are normally expressed in the adult: two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin. Two alpha chains plus two delta chains constitute HbA-2, which with HbF comprises the remaining 3% of adult hemoglobin. Five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in the following order: 5'-epsilon--Ggamma--Agamma--delta--beta-3'. Mutations in the delta-globin gene are associated with beta-thalassemia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
