-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HES1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 181-280 of human HES1 (Q14469) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against HES1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 181-280 of human HES1 (Q14469) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-17027A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HES1 |
| Target Synonyms | HHL; HRY; HES-1; bHLHb39; HES1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat testis | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 181-280 of human HES1 (Q14469). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN | Uniprot ID | Q14469 |
Uniprot Id
Q14469
Target Species
Human
Target Name
HES1
Target Full Name
Transcription factor HES-1
Target Function
Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity. May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage.
Target Subcellular Location
Nucleus.
Target Synonyms
bHLHb39; C-HAIRY1; c-hairy1A; Class B basic helix-loop-helix protein 39; FLJ20408; Hairy and enhancer of split 1 (Drosophila); Hairy and enhancer of split 1; Hairy homolog (Drosophila); Hairy homolog; Hairy like ; Hairy, Drosophila, homolog of; Hairy-like protein; Hairy/enhancer of split, Drosophila, homolog of, 1; HAIRY1; HES-1; hes1; Hes1 hairy and enhancer of split 1 (Drosophila); HES1_HUMAN; HHL; HL; HRY; MGC129109; OTTHUMP00000209031; RHL; Transcription factor HES-1
Target Background
This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.
Notification