Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HILPDA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human HILPDA (NP_037464.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against HILPDA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human HILPDA (NP_037464.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of HILPDA in paraffin-embedded Rat liver using HILPDA Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-07226A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HILPDA |
| Target Synonyms | HIG2; HIG-2; C7orf68; HILPDA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human HILPDA (NP_037464.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM | Uniprot ID | Q9Y5L2 |
Uniprot Id
Q9Y5L2
Target Species
Human
Target Name
HILPDA
Target Full Name
Hypoxia-inducible lipid droplet-associated protein
Target Function
Increases intracellular lipid accumulation. Stimulates expression of cytokines including IL6, MIF and VEGFA. Enhances cell growth and proliferation.
Target Subcellular Location
Lipid droplet. Secreted. Membrane; Single-pass membrane protein.
Target Tissue Specificity
Highly expressed in renal cell carcinoma cells but barely detectable in adjacent normal kidney tissue. Detected in some cervical and endometrial cancers. Expression also detected in fetal kidney with little or no expression observed in normal adult heart,
Target Synonyms
C7orf68; chromosome 7 open reading frame 68; HIG 2; HIG2; HIG2_HUMAN; HILPDA; hypoxia inducible gene 2; Hypoxia-inducible gene 2 protein; Hypoxia-inducible lipid droplet-associated protein; Hypoxia-inducible protein 2
Target Background
Enables signaling receptor binding activity. Involved in several processes, including autocrine signaling; cellular response to hypoxia; and positive regulation of lipid storage. Located in several cellular components, including cell surface; lipid droplet; and secretory granule.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
