-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HKDC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human HKDC1 (NP_079406.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HKDC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human HKDC1 (NP_079406.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08725A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HKDC1 |
| Target Synonyms | RP92; HKDC1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, SW620, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HKDC1 (NP_079406.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYMEDMSNIDLVEG | Uniprot ID | Q2TB90 |
Uniprot Id
Q2TB90
Target Species
Human
Target Name
HKDC1
Target Full Name
Hexokinase HKDC1
Target Function
Catalyzes the phosphorylation of hexose to hexose 6-phosphate, although at very low level compared to other hexokinases. Has low glucose phosphorylating activity compared to other hexokinases. Involved in glucose homeostasis and hepatic lipid accumulation. Required to maintain whole-body glucose homeostasis during pregnancy; however additional evidences are required to confirm this role.
Target Subcellular Location
Mitochondrion membrane; Peripheral membrane protein.
Target Protein Families
Hexokinase family
Target Tissue Specificity
Widely expressed. Highly expressed in the brush border, surface epithelium and the myenteric plexus of the small and large intestines; the acinar centrocytes and interlobular ducts of the pancreas; and the alveolar macrophages in the lungs (at protein lev
Target Synonyms
BC016235; Hexokinase domain containing 1; Hexokinase domain-containing protein 1; Hkdc1; HKDC1_HUMAN; Putative hexokinase HKDC1
Target Background
This gene encodes a member of the hexokinase protein family. The encoded protein is involved in glucose metabolism, and reduced expression may be associated with gestational diabetes mellitus. High expression of this gene may also be associated with poor prognosis in hepatocarcinoma.
Notification