-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HMGCS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 409-508 of human HMGCS2 (P54868) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HMGCS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 409-508 of human HMGCS2 (P54868) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14377A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HMGCS2 |
| Target Synonyms | HMGCS2; Hydroxymethylglutaryl-CoA synthase; mitochondrial; 3-hydroxy-3-methylglutaryl coenzyme A synthase; 3-hydroxy-3-methylglutaryl-CoA synthase 2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse liver, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 409-508 of human HMGCS2 (P54868). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AFSYGSGLAASFFSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV | Uniprot ID | P54868 |
Uniprot Id
P54868
Target Species
Human
Target Name
HMGCS2
Target Full Name
Hydroxymethylglutaryl-CoA synthase, mitochondrial
Target Function
Catalyzes the first irreversible step in ketogenesis, condensing acetyl-CoA to acetoacetyl-CoA to form HMG-CoA, which is converted by HMG-CoA reductase (HMGCR) into mevalonate.
Target Involvement
3-hydroxy-3-methylglutaryl-CoA synthase-2 deficiency (HMGCS2D)
Target Subcellular Location
Mitochondrion.
Target Protein Families
HMG-CoA synthase family
Target Tissue Specificity
Expression in liver is 200-fold higher than in any other tissue. Low expression in colon, kidney, testis, and pancreas. Very low expression in heart and skeletal muscle. Not detected in brain.; [Isoform 3]: Highest expression detected in heart and skeleta
Target Synonyms
3 hydroxy 3 methylglutaryl Coenzyme A synthase 2 (mitochondrial); 3 hydroxy 3 methylglutaryl Coenzyme A synthase 2; 3 hydroxy 3 methylglutaryl coenzyme A synthase; 3-hydroxy-3-methylglutaryl coenzyme A synthase; HMCS2_HUMAN; HMG CoA synthase; HMG-CoA synthase; HMGCS 2; HMGCS2; Hydroxymethylglutaryl CoA synthase; Hydroxymethylglutaryl CoA synthase mitochondrial ; Hydroxymethylglutaryl-CoA synthase; mitochondrial
Target Background
The protein encoded by this gene belongs to the HMG-CoA synthase family. It is a mitochondrial enzyme that catalyzes the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for various organs during times of carbohydrate deprivation, such as fasting. Mutations in this gene are associated with HMG-CoA synthase deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification