-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HOMER1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 71-170 of human HOMER1 (NP_004263.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HOMER1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 71-170 of human HOMER1 (NP_004263.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08558A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HOMER1 |
| Target Synonyms | HOMER; SYN47; Ves-1; HOMER1A; HOMER1B; HOMER1C | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 71-170 of human HOMER1 (NP_004263.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNA | Uniprot ID | Q86YM7 |
Uniprot Id
Q86YM7
Target Species
Human
Target Name
HOMER1
Target Full Name
Homer protein homolog 1
Target Function
Postsynaptic density scaffolding protein. Binds and cross-links cytoplasmic regions of GRM1, GRM5, ITPR1, DNM3, RYR1, RYR2, SHANK1 and SHANK3. By physically linking GRM1 and GRM5 with ER-associated ITPR1 receptors, it aids the coupling of surface receptors to intracellular calcium release. May also couple GRM1 to PI3 kinase through its interaction with AGAP2. Isoform 1 regulates the trafficking and surface expression of GRM5. Isoform 3 acts as a natural dominant negative, in dynamic competition with constitutively expressed isoform 1 to regulate synaptic metabotropic glutamate function. Isoform 3, may be involved in the structural changes that occur at synapses during long-lasting neuronal plasticity and development. Forms a high-order complex with SHANK1, which in turn is necessary for the structural and functional integrity of dendritic spines. Negatively regulates T cell activation by inhibiting the calcineurin-NFAT pathway. Acts by competing with calcineurin/PPP3CA for NFAT protein binding, hence preventing NFAT activation by PPP3CA.
Target Subcellular Location
Cytoplasm. Cell junction, synapse, postsynaptic density. Cell junction, synapse. Cell projection, dendritic spine.
Target Protein Families
Homer family
Target Research Area
Neuroscience
Target Synonyms
HOME1_HUMAN; Homer ; HOMER 1A; HOMER 1B ; HOMER 1C; Homer homolog 1 (Drosophila); homer homolog 1; Homer protein homolog 1; homer scaffolding protein 1; Homer; Drosophila; homolog of; 1; Homer; neuronal immediate early gene; 1 ; Homer-1; Homer1; HOMER1A; HOMER1B; HOMER1C; SYN47 ; Ves 1
Target Background
This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.
Notification