-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPB11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human HSPB11 (NP_057210.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against HSPB11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human HSPB11 (NP_057210.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07231A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPB11 |
| Target Synonyms | PP25; FAP232; HSPB11; C1orf41; CFAP232; HSPCO34 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, A-549, Mouse brain, Rat thymus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human HSPB11 (NP_057210.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS | Uniprot ID | Q9Y547 |
Uniprot Id
Q9Y547
Target Species
Human
Target Name
IFT25
Target Full Name
Intraflagellar transport protein 25 homolog
Target Function
Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly. Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation. Plays a role in the early development of the kidney. May be involved in the regulation of ureteric bud initiation.
Target Subcellular Location
Cell projection, cilium.
Target Protein Families
IFT25 family
Target Tissue Specificity
Detected in placenta.
Target Synonyms
Chromosome 1 open reading frame 41; Heat shock protein beta-11; HSB11_HUMAN; Hspb11; HSPCO34; IFT25; Placental protein 25; PP25
Target Background
Predicted to enable metal ion binding activity. Predicted to be involved in kidney development and spermatogenesis. Predicted to act upstream of or within animal organ development; left/right axis specification; and skeletal system development. Predicted to be located in ciliary tip. Predicted to be part of intraciliary transport particle B. Predicted to be active in centrosome and cilium.
Notification