-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HVCN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HVCN1 (NP_115745.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HVCN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HVCN1 (NP_115745.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01074A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HVCN1 |
| Target Synonyms | HV1; VSOP; HVCN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | B cells, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HVCN1 (NP_115745.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHR | Uniprot ID | Q96D96 |
Uniprot Id
Q96D96
Target Species
Human
Target Name
HVCN1
Target Full Name
Voltage-gated hydrogen channel 1
Target Function
Mediates the voltage-dependent proton permeability of excitable membranes. Forms a proton-selective channel through which protons may pass in accordance with their electrochemical gradient. Proton efflux, accompanied by membrane depolarization, facilitates acute production of reactive oxygen species in phagocytosis.
Target Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Note=Detected mainly at intracellular membranes upon overexpression in HeLa cells (PuMed:20147290), but not in other cell types.
Target Protein Families
Hydrogen channel family
Target Tissue Specificity
Enriched in immune tissues, such as lymph nodes, B-lymphocytes, monocytes and spleen.
Target Synonyms
HVCN1; VSOP; UNQ578/PRO1140; Voltage-gated hydrogen channel 1; Hydrogen voltage-gated channel 1; HV1; Voltage sensor domain-only protein
Target Background
This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody production. This same channel protein, however, can also regulate functions in other cells including spermatozoa. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification