Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IFNA10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human IFNA10 (NP_002162.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IFNA10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human IFNA10 (NP_002162.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04076A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IFNA10 |
| Target Synonyms | IFN-alphaC; IFNA10 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat plasma | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human IFNA10 (NP_002162.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW | Uniprot ID | P01566 |
Uniprot Id
P01566
Target Species
Human
Target Name
IFNA10
Target Full Name
Interferon alpha-10
Target Function
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Target Subcellular Location
Secreted.
Target Protein Families
Alpha/beta interferon family
Target Research Area
Immunology
Target Synonyms
IFN-alpha-10; IFN10_HUMAN; IFNA10; Interferon alpha 6L; Interferon alpha C; Interferon alpha-10; Interferon alpha-6L; Interferon alpha-C; interferon, alpha 10; LeIF C; MGC119878; MGC119879
Target Background
This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses and other pathogens or tumor cells. This gene is intronless and the encoded protein is secreted.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
