-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IGFBP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 226-325 of human IGFBP2 (P18065) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against IGFBP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 226-325 of human IGFBP2 (P18065) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15796A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IGFBP2 |
| Target Synonyms | IBP2; IGF-BP53; IGFBP2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, PC-3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 226-325 of human IGFBP2 (P18065). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQ | Uniprot ID | P18065 |
Uniprot Id
P18065
Target Species
Human
Target Name
IGFBP2
Target Full Name
Insulin-like growth factor-binding protein 2
Target Function
Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
Target Subcellular Location
Secreted.
Target Synonyms
BP 2; BP2; IBP 2; IBP-2; IBP2; IBP2_HUMAN; IGF binding protein 2; IGF BP53; IGF-binding protein 2; IGFBP 2; IGFBP-2; IGFBP2; IGFBP53; Insulin like growth factor binding protein 2 36kDa; Insulin like growth factor binding protein 2; Insulin like growth factor-binding protein 2 precursor ; Insulin-like growth factor-binding protein 2
Target Background
The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene.
Notification