-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL12B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 228-328 of human IL12B (NP_002178.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against IL12B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 228-328 of human IL12B (NP_002178.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15354A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL12B |
| Target Synonyms | CLMF; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B; IL12B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse spleen, Mouse thymus, Rat spleen, Rat thymus, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 228-328 of human IL12B (NP_002178.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS | Uniprot ID | P29460 |
Uniprot Id
P29460
Target Species
Human
Target Name
IL12B
Target Full Name
Interleukin-12 subunit beta
Target Function
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.; Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Target Involvement
Immunodeficiency 29 (IMD29); Psoriasis 11 (PSORS11)
Target Subcellular Location
Secreted.
Target Protein Families
Type I cytokine receptor family, Type 3 subfamily
Target Research Area
Immunology
Target Synonyms
CLMF ; CLMF p40; CLMF2; Cytotoxic lymphocyte maturation factor 40 kDa subunit; IL 12B; IL-12 subunit p40; IL-12B; IL12 p40; IL12B; IL12B_HUMAN; IMD28; IMD29; Interleukin 12 beta chain; Interleukin 12 p40; Interleukin-12 subunit beta; NK cell stimulatory factor chain 2; NKSF ; NKSF2
Target Background
This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children.
Notification