-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 109-270 of human IL33 (NP_001300974.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against IL33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 109-270 of human IL33 (NP_001300974.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14981A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL33 |
| Target Synonyms | DVS27; IL1F11; NF-HEV; NFEHEV; C9orf26; IL33 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F transfected with IL33 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 109-270 of human IL33 (NP_001300974.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET | Uniprot ID | O95760 |
Uniprot Id
O95760
Target Species
Human
Target Name
IL33
Target Full Name
Interleukin-33
Target Function
Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.
Target Subcellular Location
Nucleus. Chromosome. Cytoplasm. Cytoplasmic vesicle, secretory vesicle. Secreted.
Target Protein Families
IL-1 family
Target Tissue Specificity
Expressed at high level in high endothelial venules found in tonsils, Peyer patches and mesenteric lymph nodes. Almost undetectable in placenta.
Target Synonyms
C9orf26; CHROMOSOME 9 OPEN READING FRAME 26; DKFZp586H0523; DVS27; DVS27 related protein; IL 1F11; IL 33; IL-1F11; IL-33; IL1F11 ; IL33; IL33_HUMAN; Interleukin 1 family member 11; Interleukin 33; INTERLEUKIN 33 NFHEV; Interleukin 33 precursor ; Interleukin-1 family member 11; Interleukin-33 (109-270); Interleukin33; NF HEV; NF-HEV; NFEHEV; NFHEV; Nuclear factor for high endothelial venules; Nuclear factor from high endothelial venules; OTTHUMP00000021041; RP11 575C20.2
Target Background
The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene.
Notification