-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against INPP5E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-630 of human INPP5E (NP_063945.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against INPP5E was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-630 of human INPP5E (NP_063945.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07059A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | INPP5E |
| Target Synonyms | CPD4; CORS1; JBTS1; MORMS; PPI5PIV; pharbin; INPP5E | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 510-630 of human INPP5E (NP_063945.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQ | Uniprot ID | Q9NRR6 |
Uniprot Id
Q9NRR6
Target Species
Human
Target Name
INPP5E
Target Full Name
Phosphatidylinositol polyphosphate 5-phosphatase type IV
Target Function
Phosphatidylinositol (PtdIns) phosphatase that specifically hydrolyzes the 5-phosphate of phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3), phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) and phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Specific for lipid substrates, inactive towards water soluble inositol phosphates. Plays an essential role in the primary cilium by controlling ciliary growth and phosphoinositide 3-kinase (PI3K) signaling and stability.
Target Involvement
Joubert syndrome 1 (JBTS1); Mental retardation, truncal obesity, retinal dystrophy, and micropenis (MORMS)
Target Subcellular Location
Cytoplasm, cytoskeleton, cilium axoneme. Golgi apparatus, Golgi stack membrane; Peripheral membrane protein; Cytoplasmic side. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, ruffle. Cytoplasm. Nucleus.
Target Protein Families
Inositol 1,4,5-trisphosphate 5-phosphatase type IV family
Target Tissue Specificity
Detected in brain, heart, pancreas, testis and spleen.
Target Synonyms
5-bisphosphate 5-phosphatase; 72 kDa inositol polyphosphate 5-phosphatase; Inositol polyphosphate 5 phosphatase; INP5E_HUMAN; Inpp5e; Phosphatidylinositol (4,5) bisphosphate 5 phosphatase; Phosphatidylinositol 4; Phosphatidylinositol polyphosphate 5 phosphatase type IV; Phosphatidylinositol polyphosphate 5-phosphatase type IV; PPI5PIV
Target Background
The protein encoded by this gene is an inositol 1, 4, 5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1, 4, 5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. Studies of the mouse counterpart suggest that this protein may hydrolyze phosphatidylinositol 3, 4, 5-trisphosphate and phosphatidylinositol 3, 5-bisphosphate on the cytoplasmic Golgi membrane and thereby regulate Golgi-vesicular trafficking. Mutations in this gene cause Joubert syndrome; a clinically and genetically heterogenous group of disorders characterized by midbrain-hindbrain malformation and various associated ciliopathies that include retinal dystrophy, nephronophthisis, liver fibrosis and polydactyly. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification