-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITGA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 85-260 of human ITGA3 (P26006) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ITGA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 85-260 of human ITGA3 (P26006) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10497A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITGA3 |
| Target Synonyms | JEB7; VL3A; CD49C; FRP-2; GAPB3; ILNEB; MSK18; VCA-2; VLA3a; GAP-B3; ITGA3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-431, A-549, Mouse lung, PC-3, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 85-260 of human ITGA3 (P26006). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFI | Uniprot ID | P26006 |
Uniprot Id
P26006
Target Species
Human
Target Name
ITGA3
Target Full Name
Integrin alpha-3
Target Function
Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.; (Microbial infection) Integrin ITGA3:ITGB1 may act as a receptor for R.delemar CotH7 in alveolar epithelial cells, which may be an early step in pulmonary mucormycosis disease progression.
Target Involvement
Interstitial lung disease, nephrotic syndrome, and epidermolysis bullosa, congenital (ILNEB)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell membrane; Lipid-anchor. Cell projection, invadopodium membrane; Single-pass type I membrane protein. Cell projection, filopodium membrane; Single-pass type I membrane protein.
Target Protein Families
Integrin alpha chain family
Target Tissue Specificity
Isoform 1 is widely expressed. Isoform 2 is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform 1 is strongly expressed on vascular smooth muscle cells, isoform 2 is det
Target Synonyms
AA407068; Antigen identified by monoclonal J143 ; CD49 antigen like family member C; CD49 antigen-like family member C; CD49c; CD49c antigen; FLJ34631; FLJ34704; FRP 2; FRP-2; FRP2; Galactoprotein B3; GAP B3; GAPB3; Integrin alpha 3; Integrin alpha-3 light chain; Integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor); ITA3_HUMAN; ITGA 3; Itga3; MSK18; VCA 2; VCA2; Very late activation protein 3 receptor alpha 3 subunit ; VL3A; VLA 3 alpha chain; VLA 3 subunit alpha; VLA-3 subunit alpha; VLA3a
Target Background
The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 3 subunit. This subunit joins with a beta 1 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. Expression of this gene may be correlated with breast cancer metastasis.
Notification