-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KAT2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A (NP_066564.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against KAT2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A (NP_066564.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08807A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KAT2A |
| Target Synonyms | GCN5; hGCN5; GCN5L2; PCAF-b; KAT2A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A (NP_066564.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRA | Uniprot ID | Q92830 |
Uniprot Id
Q92830
Target Species
Human
Target Name
KAT2A
Target Full Name
Histone acetyltransferase KAT2A
Target Function
Protein lysine acyltransferase that can act as a acetyltransferase, glutaryltransferase or succinyltransferase, depending on the context. Acts as a histone lysine succinyltransferase: catalyzes succinylation of histone H3 on 'Lys-79' (H3K79succ), with a maximum frequency around the transcription start sites of genes. Succinylation of histones gives a specific tag for epigenetic transcription activation. Association with the 2-oxoglutarate dehydrogenase complex, which provides succinyl-CoA, is required for histone succinylation. In different complexes, functions either as an acetyltransferase (HAT) or as a succinyltransferase: in the SAGA and ATAC complexes, acts as a histone acetyltransferase. Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles. Acetylation of histones gives a specific tag for epigenetic transcription activation. Recruited by the XPC complex at promoters, where it specifically mediates acetylation of histone variant H2A.Z.1/H2A.Z, thereby promoting expression of target genes. Involved in long-term memory consolidation and synaptic plasticity: acts by promoting expression of a hippocampal gene expression network linked to neuroactive receptor signaling. Acts as a positive regulator of T-cell activation: upon TCR stimulation, recruited to the IL2 promoter following interaction with NFATC2 and catalyzes acetylation of histone H3 at 'Lys-9' (H3K9ac), leading to promote IL2 expression. Required for growth and differentiation of craniofacial cartilage and bone by regulating acetylation of histone H3 at 'Lys-9' (H3K9ac). Regulates embryonic stem cell (ESC) pluripotency and differentiation. Also acetylates non-histone proteins, such as CEBPB, PLK4 and TBX5. Involved in heart and limb development by mediating acetylation of TBX5, acetylation regulating nucleocytoplasmic shuttling of TBX5. Acts as a negative regulator of centrosome amplification by mediating acetylation of PLK4. Also acts as a histone glutaryltransferase: catalyzes glutarylation of histone H4 on 'Lys-91' (H4K91glu), a mark that destabilizes nucleosomes by promoting dissociation of the H2A-H2B dimers from nucleosomes.; (Microbial infection) In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes.
Target Subcellular Location
Nucleus. Chromosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
Acetyltransferase family, GCN5 subfamily
Target Tissue Specificity
Expressed in all tissues tested, with most abundant expression in ovary.
Target Synonyms
1110051E14Rik; AW212720; EC 2.3.1.48 ; GCN 5; GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2; Gcn5; GCN5 general control of amino-acid synthesis 5-like 2 (yeast); GCN5L2; general control of amino acid synthesis 5-like 2; General control of amino acid synthesis protein 5-like 2; General control of amino acid synthesis, yeast, homolog-like 2; HGCN5; Histone acetyltransferase GCN5; Histone acetyltransferase KAT2A; hsGCN5; K(lysine) acetyltransferase 2A; KAT2 A; KAT2A; KAT2A_HUMAN; Lysine acetyltransferase 2A; MGC102791 ; PCAF-b; STAF97
Target Background
KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).
Notification