-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KAT8/MYST1/MOF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human KAT8/MYST1/MOF (NP_892003.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KAT8/MYST1/MOF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human KAT8/MYST1/MOF (NP_892003.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04382A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KAT8/MYST1/MOF |
| Target Synonyms | MOF; hMOF; MYST1; LIGOWS; ZC2HC8; KAT8/MYST1/MOF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human KAT8/MYST1/MOF (NP_892003.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPED | Uniprot ID | Q9H7Z6 |
Uniprot Id
Q9H7Z6
Target Species
Human
Target Name
KAT8
Target Full Name
Histone acetyltransferase KAT8
Target Function
Histone acetyltransferase which may be involved in transcriptional activation. May influence the function of ATM. As part of the MSL complex it is involved in acetylation of nucleosomal histone H4 producing specifically H4K16ac. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. That activity is less specific than the one of the MSL complex. Can also acetylate TP53/p53 at 'Lys-120'.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
MYST (SAS/MOZ) family
Target Synonyms
Histone acetyltransferase KAT8; Histone acetyltransferase MYST1; hMOF; K(lysine) acetyltransferase 8; KAT 8; Lysine acetyltransferase 8; MOF; MOZ; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1; MYST 1; MYST histone acetyltransferase 1; myst protein 1; MYST-1; MYST1; MYST1_HUMAN; Ortholog of Drosophila males absent on the first (MOF); Probable histone acetyltransferase MYST1; SAS2 and TIP60 protein 1; SAS2; SAS3; TIP60 protein 1; YBF2; YBF2/SAS3; ZC2HC8
Target Background
This gene encodes a member of the MYST histone acetylase protein family. The encoded protein has a characteristic MYST domain containing an acetyl-CoA-binding site, a chromodomain typical of proteins which bind histones, and a C2HC-type zinc finger. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification