Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KDM7A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 840-941 of human KDM7A(NP_085150.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against KDM7A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 840-941 of human KDM7A(NP_085150.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of?KDM7A in paraffin-embedded?rat liver tissue using?KDM7A Rabbit pAb at a dilution of 1:100 (40x lens).?High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Cat.No | ADA-08378A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KDM7A |
| Target Synonyms | JHDM1D; KDM7A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 840-941 of human KDM7A(NP_085150.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VQSRNYVDSSGSSLQNGKYMQNSNLTSGACQISNGSLSPERPVGETSFSVPLHPTKRPASNPPPISNQATKGKRPKKGMATAKQRLGKILKLNRNGHARFFV | Uniprot ID | Q6ZMT4 |
Uniprot Id
Q6ZMT4
Target Species
Human
Target Name
KDM7A
Target Full Name
Lysine-specific demethylase 7A
Target Function
Histone demethylase required for brain development. Specifically demethylates dimethylated 'Lys-9', 'Lys-27' and 'Lys-36' (H3K9me2, H3K27me2, H3K36me2, respectively) of histone H3 and monomethylated histone H4 'Lys-20' residue (H4K20Me1), thereby playing a central role in histone code. Specifically binds trimethylated 'Lys-4' of histone H3 (H3K4me3), affecting histone demethylase specificity: in presence of H3K4me3, it has no demethylase activity toward H3K9me2, while it has high activity toward H3K27me2. Demethylates H3K9me2 in absence of H3K4me3. Has activity toward H4K20Me1 only when nucleosome is used as a substrate and when not histone octamer is used as substrate
Target Subcellular Location
Nucleus.
Target Protein Families
JHDM1 histone demethylase family, JHDM1D subfamily
Target Synonyms
JHDM1D; jmjc containing protein; JmjC domain-containing histone demethylation protein 1D; jumonji containing protein; KDM7_HUMAN; kiaa1718; Lysine-specific demethylase 7
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
