-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LACTB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-290 of human LACTB (NP_116246.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LACTB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-290 of human LACTB (NP_116246.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06819A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LACTB |
| Target Synonyms | G24; MRPL56; LACTB | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-290 of human LACTB (NP_116246.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEVGAPGIVVGVSVDGKEVWSEGLGYADVENRVPCKPETVMRIASISKSLTMVALAKLWEAGKLDLDIPVQHYVPEFPEKEYEGEKVSVTTRLLISHLSGIRHYEKDIKKVKEEKAYKALKMMKENVAFEQEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQG | Uniprot ID | P83111 |
Uniprot Id
P83111
Target Species
Human
Target Name
LACTB
Target Full Name
Serine beta-lactamase-like protein LACTB, mitochondrial
Target Function
Mitochondrial serine protease that acts as a regulator of mitochondrial lipid metabolism. Acts by decreasing protein levels of PISD, a mitochondrial enzyme that converts phosphatidylserine (PtdSer) to phosphatidylethanolamine (PtdEtn), thereby affecting mitochondrial lipid metabolism. It is unclear whether it acts directly by mediating proteolysis of PISD or by mediating proteolysis of another lipid metabolism protein. Acts as a tumor suppressor that has the ability to inhibit proliferation of multiple types of breast cancer cells: probably by promoting decreased levels of PISD, thereby affecting mitochondrial lipid metabolism.
Target Subcellular Location
Mitochondrion.
Target Protein Families
Peptidase S12 family
Target Tissue Specificity
Expressed predominantly in skeletal muscle.
Target Synonyms
LACTB; MRPL56; UNQ843/PRO1781Serine beta-lactamase-like protein LACTB; mitochondrial; EC 3.4.-.-
Target Background
This gene encodes a mitochondrially-localized protein that has sequence similarity to prokaryotic beta-lactamases. Many of the residues responsible for beta-lactamase activity are not conserved in this protein, suggesting it may have a different enzymatic function. Increased expression of the related mouse gene was found to be associated with obesity. Alternative splicing results in multiple transcript variants encoding different protein isoforms.
Notification