-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LAMTOR5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human LAMTOR5 (NP_006393.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LAMTOR5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human LAMTOR5 (NP_006393.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00512A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LAMTOR5 |
| Target Synonyms | XIP; HBXIP; LAMTOR5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, HepG2, K-562, Mouse spleen, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human LAMTOR5 (NP_006393.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS | Uniprot ID | O43504 |
Uniprot Id
O43504
Target Species
Human
Target Name
LAMTOR5
Target Full Name
Ragulator complex protein LAMTOR5
Target Function
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication.
Target Subcellular Location
Lysosome. Cytoplasm, cytosol.
Target Protein Families
LAMTOR5 family
Target Tissue Specificity
Highly expressed in skeletal and cardiac muscle, followed by pancreas, kidney, liver, brain, placenta and lung. Elevated levels in both cancerous and non-cancerous liver tissue of patients with chronic HBV infection compared with hepatic tissue without HB
Target Research Area
Cell Biology
Target Synonyms
HBV X interacting protein ; HBV X-interacting protein; HBX interacting protein; HBX-interacting protein; hbxip; HBXIP_HUMAN; Hepatitis B virus X interacting protein; Hepatitis B virus X-interacting protein; LAMTOR5; Late endosomal/lysosomal adaptor MAPK and MTOR activator 5; MGC71071; Ragulator complex protein LAMTOR5; XIP
Target Background
This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus.
Notification