Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LARP1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-320 of human LARP1B (NP_060548.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against LARP1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-320 of human LARP1B (NP_060548.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03529A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LARP1B |
| Target Synonyms | LARP2; LARP1B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-320 of human LARP1B (NP_060548.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FDYSYGYQEHGERTDQPFQTELNTSMMYYYDDGTGVQVYPVEEALLKEYIKRQIEYYFSVENLERDFFLRGKMDEQGFLPISLIAGFQRVQALTTNLNLILEALKDSTEVEIVDEKMRKKIEPEKWPIPGPPPRSVPPTDFSQLIDCPEFV | Uniprot ID | Q659C4 |
Uniprot Id
Q659C4
Target Species
Human
Target Name
LARP1B
Target Full Name
La-related protein 1B
Target Research Area
Cell Biology
Target Synonyms
LARP1B; LARP2; La-related protein 1B; La ribonucleoprotein domain family member 1B; La ribonucleoprotein domain family member 2; La-related protein 2
Target Background
This gene encodes a protein containing domains found in the La related protein of Drosophila melanogaster. La motif-containing proteins are thought to be RNA-binding proteins, where the La motif and adjacent amino acids fold into an RNA recognition motif. The La motif is also found in proteins unrelated to the La protein. Alternative splicing has been observed at this locus and multiple variants, encoding distinct isoforms, are described. Additional splice variation has been identified but the full-length nature of these transcripts has not been determined.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
