Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LDB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 204-373 of human LDB2 (NP_001281.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against LDB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 204-373 of human LDB2 (NP_001281.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01553A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LDB2 |
| Target Synonyms | LDB1; CLIM1; LDB-2; LDB2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Raji, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 204-373 of human LDB2 (NP_001281.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTGSKKKTTAANLSLSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQASQ | Uniprot ID | O43679 |
Uniprot Id
O43679
Target Species
Human
Target Name
LDB2
Target Full Name
LIM domain-binding protein 2
Target Function
Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors.
Target Subcellular Location
Nucleus.
Target Protein Families
LDB family
Target Synonyms
Carboxyl terminal LIM domain binding protein 1; Carboxyl terminal LIM domain protein 1; Carboxyl-terminal LIM domain-binding protein 1; CLIM 1; CLIM-1; CLIM1; LDB 1; LDB 2; LDB-2; LDB1; LDB2; LDB2_HUMAN; LIM binding domain 2; LIM domain binding 2; LIM domain binding factor 2; LIM domain binding factor CLIM 1; LIM domain binding factor CLIM1; LIM domain binding protein 2; LIM domain-binding factor CLIM1; LIM domain-binding protein 2; OTTHUMP00000158632; OTTHUMP00000217823; OTTHUMP00000217824; OTTHUMP00000217825; OTTHUMP00000217827
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
