-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LITAF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human LITAF (NP_004853.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against LITAF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human LITAF (NP_004853.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-13386A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LITAF |
| Target Synonyms | PIG7; SIMPLE; TP53I7; AF | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human LITAF (NP_004853.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL | Uniprot ID | Q99732 |
Uniprot Id
Q99732
Target Species
Human
Target Name
LITAF
Target Full Name
Lipopolysaccharide-induced tumor necrosis factor-alpha factor
Target Function
Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps downregulate downstream signaling cascades. Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes. Probably plays a role in regulating protein degradation via its interaction with NEDD4. May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines. May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10.
Target Involvement
Charcot-Marie-Tooth disease 1C (CMT1C)
Target Subcellular Location
Cytoplasm. Nucleus. Lysosome membrane; Peripheral membrane protein; Cytoplasmic side. Early endosome membrane. Late endosome membrane. Endosome membrane; Peripheral membrane protein; Cytoplasmic side. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Golgi apparatus membrane.
Target Protein Families
CDIP1/LITAF family
Target Tissue Specificity
Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.
Target Research Area
Signal Transduction
Target Synonyms
Lipopolysaccharide induced TNF alpha factor; CMT1C; FLJ38636; Lipopolysaccharide induced TNF alpha factor; Lipopolysaccharide induced TNF factor; Lipopolysaccharide induced tumor necrosis factor alpha factor; Lipopolysaccharide-induced tumor necrosis factor-alpha factor; LITAF; LITAF_HUMAN; LPS induced TNF alpha factor; LPS-induced TNF-alpha factor; MGC116698; MGC116700; MGC116701; MGC125274; MGC125275; MGC125276; p53 induced gene 7 protein; p53-induced gene 7 protein; PIG 7; PIG7; SIMPLE; Small integral membrane protein of lysosome/late endosome; TP53I7; Tumor protein p53 inducible protein 7
Target Background
Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene.
Notification