-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Lrwd1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Lrwd1 (NP_690852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Lrwd1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Lrwd1 (NP_690852.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07690A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Lrwd1 |
| Target Synonyms | ORCA; CENP-33; Lrwd1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Lrwd1 (NP_690852.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAFEPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTAL | Uniprot ID | Q9UFC0 |
Uniprot Id
Q9UFC0
Target Species
Human
Target Name
LRWD1
Target Full Name
Leucine-rich repeat and WD repeat-containing protein 1
Target Function
Required for G1/S transition. Recruits and stabilizes the origin recognition complex (ORC) onto chromatin during G1 to establish pre-replication complex (preRC) and to heterochromatic sites in post-replicated cells. Binds a combination of DNA and histone methylation repressive marks on heterochromatin. Binds histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3 in a cooperative manner with DNA methylation. Required for silencing of major satellite repeats. May be important ORC2, ORC3 and ORC4 stability.
Target Subcellular Location
Nucleus. Chromosome, centromere. Chromosome, telomere. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Chromosome, centromere, kinetochore. Note=Localizes to heterochromatin during G1 phase. Restricted to centromeres or telomeres as cells progress though S phase. When cells enter mitosis, relocalizes to centromeres. Recruitment to pericentric heterochromatin largely depends on the presence of H3K9me3.
Target Protein Families
LRWD1 family
Target Tissue Specificity
Testis-specific. Drastically down-regulated in testis from patients with Sertoli cell-only syndrome (SCOS).
Target Synonyms
1200011O22Rik; AU042569; AW548074; DKFZp434K1815; Leucine rich repeats and WD repeat domain containing 1; Leucine-rich repeat and WD repeat-containing protein 1; LRWD1; LRWD1_HUMAN; ORC-associated protein; ORCA; Origin recognition complex-associated protein
Target Background
The protein encoded by this gene interacts with components of the origin recognition complex (ORC) and regulates the formation of the prereplicative complex. The encoded protein stabilizes the ORC and therefore aids in DNA replication. This protein is required for the G1/S phase transition of the cell cycle. In addition, the encoded protein binds to trimethylated histone H3 in heterochromatin and recruits the ORC and lysine methyltransferases, which help maintain the repressive heterochromatic state. Two transcript variants encoding different isoforms have been found for this gene.
Notification